- COVID-19
-
Białka
- Zestawy Minute™ do izolacji
- Białka rekombinowane
-
Badania białka
-
Bufory i złoża
- Bloty
- Markery
-
Przeciwciała
-
Przeciwciała THE Elite
- PEG (mysie)
- anty-His-tagowe monoklonalne (mysie)
- anty-GST-tagowe (mysie)
- Flag-Tag monoklonalne (mysie)
- Anty-c-Myc-Tagowe monoklonalne (mysie)
- anty-HA-Tagowe (mysie, ptasie)
- GFP (królicze)
- monoklonalne anty-V5-Tagowe (mysie)
- monoklonalne anty-NWSHPQFEK-Tagowe (mysie)
- beta Actin (mysie)
- alpha Tubulin (mysie)
- monoklonalne anty-cAMP/cGMP (mysie)
- monoklonalne anty-BrdU (mysie)
- Protein C-Tag, monoklonalne (mysie)
- Przeciwciała IVD
- Przeciwciała Epitope Tag Antibodies
- Przeciwciała pierwszorzędowe
- Przeciwciała MiniFresh
- Przeciwciała drugorzędowe
-
Przeciwciała THE Elite
- Peptydy, bufory, aminokwasy
-
Biologia molekularna
- Endotoksyny
- Nerbe Plus
- Elektroforeza
beta-Amyloid (1-40)
633,20 zł
Brutto
0,5mg
Security policy
(edit with the Customer Reassurance module)
Delivery policy
(edit with the Customer Reassurance module)
Return policy
(edit with the Customer Reassurance module)
Full Name | β-Amyloid (1-40) | |
---|---|---|
Alias |
amyloid peptide; amyloid beta protein; beta amyloid plaques
|
|
Sequence (one-letter code) |
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
|
|
Sequence (three-letter code) |
{ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP} {VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
|
|
Description |
Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
|
|
Solubility |
Insoluble in water, may be dissolved in any buffer of pH >9.
|
|
MW |
4329.820
|
|
Formula |
C194H295N53O58S1
|
|
Purity |
> 95%
|
|
Storage |
Store at -20°C
|
|
Notes |
In culture, beta-amyloid peptide is neurotrophic to undifferentiated hippocampal neurons at low concentrations and neurotoxic to mature neurons at higher concentrations. In differentiated neurons, it causes dendritic and axonal retraction followed by neuronal death.
|
|
Document-COA
|
GS1987